Anti NOD2 pAb (ATL-HPA041985 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041985-25

Protein Description: nucleotide-binding oligomerization domain containing 2
Gene Name: NOD2
Alternative Gene Name: BLAU, CARD15, CD, CLR16.3, IBD1, NLRC2, PSORAS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055994: 73%, ENSRNOG00000014124: 72%
Entrez Gene ID: 64127
Uniprot ID: Q9HC29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPI
• Gene Sequence: VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPI
• Gene ID - Mouse: ENSMUSG00000055994
• Gene ID - Rat: ENSRNOG00000014124
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.