Anti NOA1 pAb (ATL-HPA035839 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035839-25

Protein Description: nitric oxide associated 1
Gene Name: NOA1
Alternative Gene Name: C4orf14, hAtNOS1, hNOA1, MGC3232, MTG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036285: 72%, ENSRNOG00000002055: 72%
Entrez Gene ID: 84273
Uniprot ID: Q8NC60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVAEDIMLKEGLGASEAVADIKFSSAGWVSVTPNFKDRLHLRGYTPEGTVLTVRPPLLPYIVNIKGQRIKKSVAYKTKKPPSLMYNVRKKKGKIN
• Gene Sequence: LVAEDIMLKEGLGASEAVADIKFSSAGWVSVTPNFKDRLHLRGYTPEGTVLTVRPPLLPYIVNIKGQRIKKSVAYKTKKPPSLMYNVRKKKGKIN
• Gene ID - Mouse: ENSMUSG00000036285
• Gene ID - Rat: ENSRNOG00000002055
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.