Anti NME9 pAb (ATL-HPA043881 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043881-25

Protein Description: NME/NM23 family member 9
Gene Name: NME9
Alternative Gene Name: NM23-H9, TXL-2, TXNDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046242: 77%, ENSRNOG00000056297: 31%
Entrez Gene ID: 347736
Uniprot ID: Q86XW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDKDTEAPQGGEAEATAGPTEALCFPEDVD
• Gene Sequence: PNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDKDTEAPQGGEAEATAGPTEALCFPEDVD
• Gene ID - Mouse: ENSMUSG00000046242
• Gene ID - Rat: ENSRNOG00000056297
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.