Anti NME7 pAb (ATL-HPA054289)

Atlas Antibodies

Catalog No.: ATL-HPA054289-25

Protein Description: NME/NM23 family member 7
Gene Name: NME7
Alternative Gene Name: CFAP67, FLJ37194, NM23-H7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026575: 87%, ENSRNOG00000002898: 88%
Entrez Gene ID: 29922
Uniprot ID: Q9Y5B8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVN
• Gene Sequence: SIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVN
• Gene ID - Mouse: ENSMUSG00000026575
• Gene ID - Rat: ENSRNOG00000002898
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.