Anti NLRP14 pAb (ATL-HPA039477)

Atlas Antibodies

Catalog No.: ATL-HPA039477-25

Protein Description: NLR family, pyrin domain containing 14
Gene Name: NLRP14
Alternative Gene Name: CLR11.2, GC-LRR, Nalp-iota, NALP14, NOD5, PAN8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039501: 24%, ENSRNOG00000023847: 26%
Entrez Gene ID: 338323
Uniprot ID: Q86W24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKAWSVSLKIFGKMNLKDLCERAKEEINWSAQTIGPDDAKAGETQEDQEAVLGDGTEYRNRIKEKFCITWDKKSLAGKPEDFHHGIAEKDRKLLEHLFDVDVK
• Gene Sequence: EKAWSVSLKIFGKMNLKDLCERAKEEINWSAQTIGPDDAKAGETQEDQEAVLGDGTEYRNRIKEKFCITWDKKSLAGKPEDFHHGIAEKDRKLLEHLFDVDVK
• Gene ID - Mouse: ENSMUSG00000039501
• Gene ID - Rat: ENSRNOG00000023847
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.