Anti NLRP12 pAb (ATL-HPA042981)

Atlas Antibodies

Catalog No.: ATL-HPA042981-25

Protein Description: NLR family, pyrin domain containing 12
Gene Name: NLRP12
Alternative Gene Name: CLR19.3, Monarch1, NALP12, PAN6, PYPAF7, RNO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097297: 54%, ENSRNOG00000060745: 53%
Entrez Gene ID: 91662
Uniprot ID: P59046
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKRCRSAQVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSLYRNALGS
• Gene Sequence: LKRCRSAQVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSLYRNALGS
• Gene ID - Mouse: ENSMUSG00000097297
• Gene ID - Rat: ENSRNOG00000060745
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.