Anti NIPSNAP3A pAb (ATL-HPA042491)

Atlas Antibodies

Catalog No.: ATL-HPA042491-25

Protein Description: nipsnap homolog 3A (C. elegans)
Gene Name: NIPSNAP3A
Alternative Gene Name: DKFZp564D177, FLJ13953, HSPC299, MGC14553
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015247: 89%, ENSRNOG00000010332: 91%
Entrez Gene ID: 25934
Uniprot ID: Q9UFN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIP
• Gene Sequence: VHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIP
• Gene ID - Mouse: ENSMUSG00000015247
• Gene ID - Rat: ENSRNOG00000010332
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.