Anti NFKBIZ pAb (ATL-HPA075363)

Atlas Antibodies

Catalog No.: ATL-HPA075363-25

Protein Description: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta
Gene Name: NFKBIZ
Alternative Gene Name: FLJ34463, INAP, MAIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035356: 49%, ENSRNOG00000031163: 39%
Entrez Gene ID: 64332
Uniprot ID: Q9BYH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CQPFQVRGSQQMIDQASLYQYSPQNQHVEQQPHYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRESENIANPM
• Gene Sequence: CQPFQVRGSQQMIDQASLYQYSPQNQHVEQQPHYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRESENIANPM
• Gene ID - Mouse: ENSMUSG00000035356
• Gene ID - Rat: ENSRNOG00000031163
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.