Anti NFKB1 pAb (ATL-HPA027305 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027305-25

Protein Description: nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Gene Name: NFKB1
Alternative Gene Name: KBF1, NF-kappaB, NF-kB1, NFkappaB, NFKB-p50, p105, p50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028163: 60%, ENSRNOG00000023258: 62%
Entrez Gene ID: 4790
Uniprot ID: P19838
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV
• Gene Sequence: GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV
• Gene ID - Mouse: ENSMUSG00000028163
• Gene ID - Rat: ENSRNOG00000023258
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NFKB1 pAb (ATL-HPA027305 w/enhanced validation) – 4 Found

Avnet, Sofia; Di Pompo, Gemma; Chano, Tokuhiro; Errani, Costantino; Ibrahim-Hashim, Arig; Gillies, Robert J; Donati, Davide Maria; Baldini, Nicola. Cancer-associated mesenchymal stroma fosters the stemness of osteosarcoma cells in response to intratumoral acidosis via NF-κB activation. International Journal Of Cancer. 2017;140(6):1331-1345. 

Kok, Fatma O; Wang, Haoying; Riedlova, Patricia; Goodyear, Carl S; Carmody, Ruaidhrí J. Defining the structure of the NF-ĸB pathway in human immune cells using quantitative proteomic data. Cellular Signalling. 2021;88( 34562606):110154. 

Chen, Yung-Che; Hsu, Po-Yuan; Su, Mao-Chang; Chen, Ting-Wen; Hsiao, Chang-Chun; Chin, Chien-Hung; Liou, Chia-Wei; Wang, Po-Wen; Wang, Ting-Ya; Lin, Yong-Yong; Lee, Chiu-Ping; Lin, Meng-Chih. MicroRNA Sequencing Analysis in Obstructive Sleep Apnea and Depression: Anti-Oxidant and MAOA-Inhibiting Effects of miR-15b-5p and miR-92b-3p through Targeting PTGS1-NF-κB-SP1 Signaling. Antioxidants (Basel, Switzerland). 2021;10(11) 

Kershner, Leah J; Choi, Kwangmin; Wu, Jianqiang; Zhang, Xiyuan; Perrino, Melissa; Salomonis, Nathan; Shern, Jack F; Ratner, Nancy. Multiple Nf1 Schwann cell populations reprogram the plexiform neurofibroma tumor microenvironment. Jci Insight. 2022;7(18)