Anti NFATC2 pAb (ATL-HPA024369 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024369-25

Protein Description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
Gene Name: NFATC2
Alternative Gene Name: NF-ATP, NFAT1, NFATp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027544: 85%, ENSRNOG00000012175: 84%
Entrez Gene ID: 4773
Uniprot ID: Q13469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTN
• Gene Sequence: GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTN
• Gene ID - Mouse: ENSMUSG00000027544
• Gene ID - Rat: ENSRNOG00000012175
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NFATC2 pAb (ATL-HPA024369 w/enhanced validation) – 1 Found

Peuker, Kenneth; Muff, Stefanie; Wang, Jun; Künzel, Sven; Bosse, Esther; Zeissig, Yvonne; Luzzi, Giuseppina; Basic, Marijana; Strigli, Anne; Ulbricht, Andrea; Kaser, Arthur; Arlt, Alexander; Chavakis, Triantafyllos; van den Brink, Gijs R; Schafmayer, Clemens; Egberts, Jan-Hendrik; Becker, Thomas; Bianchi, Marco E; Bleich, André; Röcken, Christoph; Hampe, Jochen; Schreiber, Stefan; Baines, John F; Blumberg, Richard S; Zeissig, Sebastian. Epithelial calcineurin controls microbiota-dependent intestinal tumor development. Nature Medicine. 2016;22(5):506-15.