Anti NFAT5 pAb (ATL-HPA057304)

Atlas Antibodies

Catalog No.: ATL-HPA057304-25

Protein Description: nuclear factor of activated T-cells 5, tonicity-responsive
Gene Name: NFAT5
Alternative Gene Name: KIAA0827, NF-AT5, NFATL1, NFATZ, OREBP, TONEBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003847: 91%, ENSRNOG00000011879: 87%
Entrez Gene ID: 10725
Uniprot ID: O94916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNEDMQMQCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQN
• Gene Sequence: TNEDMQMQCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQN
• Gene ID - Mouse: ENSMUSG00000003847
• Gene ID - Rat: ENSRNOG00000011879
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.