Anti NETO2 pAb (ATL-HPA013180)

Atlas Antibodies

Catalog No.: ATL-HPA013180-25

Protein Description: neuropilin (NRP) and tolloid (TLL)-like 2
Gene Name: NETO2
Alternative Gene Name: FLJ10430, NEOT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036902: 97%, ENSRNOG00000016245: 98%
Entrez Gene ID: 81831
Uniprot ID: Q8NC67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Source: Polyclonal
• Immunogen: SYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKA
• Gene Sequence: SYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKA
• Gene ID - Mouse: ENSMUSG00000036902
• Gene ID - Rat: ENSRNOG00000016245
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NETO2 pAb (ATL-HPA013180) – 3 Found

Copits, Bryan A; Robbins, John S; Frausto, Shanti; Swanson, Geoffrey T. Synaptic targeting and functional modulation of GluK1 kainate receptors by the auxiliary neuropilin and tolloid-like (NETO) proteins. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2011;31(20):7334-40. 

Lomash, Richa Madan; Sheng, Nengyin; Li, Yan; Nicoll, Roger A; Roche, Katherine W. Phosphorylation of the kainate receptor (KAR) auxiliary subunit Neto2 at serine 409 regulates synaptic targeting of the KAR subunit GluK1. The Journal Of Biological Chemistry. 2017;292(37):15369-15377. 

Li, Youwei; Wang, Wei; Hou, Xiaoshuang; Huang, Wenda; Zhang, Po; He, Yue; Wang, Baofeng; Duan, Qiuhong; Mao, Feng; Guo, Dongsheng. Glioma-derived LRIG3 interacts with NETO2 in tumor-associated macrophages to modulate microenvironment and suppress tumor growth. Cell Death & Disease. 2023;14(1):28.