Anti NEPRO pAb (ATL-HPA069654)

Atlas Antibodies

Catalog No.: ATL-HPA069654-25

Protein Description: nucleolus and neural progenitor protein
Gene Name: NEPRO
Alternative Gene Name: C3orf17, DKFZP434F2021, NET17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036208: 59%, ENSRNOG00000013721: 52%
Entrez Gene ID: 25871
Uniprot ID: Q6NW34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTFPSDITEFLGQPYFEAFKKKMPIAFAAKGINKLLNKLFLINEQSPRASEETLLGISKKAKQMKINVQNNVDLG
• Gene Sequence: FTFPSDITEFLGQPYFEAFKKKMPIAFAAKGINKLLNKLFLINEQSPRASEETLLGISKKAKQMKINVQNNVDLG
• Gene ID - Mouse: ENSMUSG00000036208
• Gene ID - Rat: ENSRNOG00000013721
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.