Anti NEK3 pAb (ATL-HPA043230 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043230-25

Protein Description: NIMA-related kinase 3
Gene Name: NEK3
Alternative Gene Name: HSPK36, MGC29949
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031478: 75%, ENSRNOG00000012757: 74%
Entrez Gene ID: 4752
Uniprot ID: P51956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEED
• Gene Sequence: RGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEED
• Gene ID - Mouse: ENSMUSG00000031478
• Gene ID - Rat: ENSRNOG00000012757
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.