Anti NEK1 pAb (ATL-HPA040413 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040413-25

Protein Description: NIMA-related kinase 1
Gene Name: NEK1
Alternative Gene Name: KIAA1901, NY-REN-55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031644: 81%, ENSRNOG00000010418: 80%
Entrez Gene ID: 4750
Uniprot ID: Q96PY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKR
• Gene Sequence: VLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKR
• Gene ID - Mouse: ENSMUSG00000031644
• Gene ID - Rat: ENSRNOG00000010418
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NEK1 pAb (ATL-HPA040413 w/enhanced validation) – 1 Found

Freund, Isabel; Hehlgans, Stephanie; Martin, Daniel; Ensminger, Michael; Fokas, Emmanouil; Rödel, Claus; Löbrich, Markus; Rödel, Franz. Fractionation-Dependent Radiosensitization by Molecular Targeting of Nek1. Cells. 2020;9(5)