Anti NEDD4 pAb (ATL-HPA039883)

Atlas Antibodies

Catalog No.: ATL-HPA039883-25

Protein Description: neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase
Gene Name: NEDD4
Alternative Gene Name: KIAA0093, MGC176705, NEDD4-1, RPF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024386: 26%, ENSRNOG00000018980: 22%
Entrez Gene ID: 4734
Uniprot ID: P46934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLHSDSEYIKLMHRTSACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLG
• Gene Sequence: TVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLHSDSEYIKLMHRTSACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLG
• Gene ID - Mouse: ENSMUSG00000024386
• Gene ID - Rat: ENSRNOG00000018980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.