Anti NDUFB4 pAb (ATL-HPA051739 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA051739-25

Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa
Gene Name: NDUFB4
Alternative Gene Name: B15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022820: 74%, ENSRNOG00000032733: 72%
Entrez Gene ID: 4710
Uniprot ID: O95168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQL
• Gene Sequence: MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQL
• Gene ID - Mouse: ENSMUSG00000022820
• Gene ID - Rat: ENSRNOG00000032733
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.