Anti NDUFAF2 pAb (ATL-HPA048082 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA048082-25

Protein Description: NADH dehydrogenase (ubiquinone) complex I, assembly factor 2
Gene Name: NDUFAF2
Alternative Gene Name: B17.2L, mimitin, MMTN, NDUFA12L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068184: 80%, ENSRNOG00000055079: 75%
Entrez Gene ID: 91942
Uniprot ID: Q8N183
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPP
• Gene Sequence: MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPP
• Gene ID - Mouse: ENSMUSG00000068184
• Gene ID - Rat: ENSRNOG00000055079
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.