Anti NCF4 pAb (ATL-HPA057975)

Atlas Antibodies

SKU: ATL-HPA057975-25

• 

Protein Description: neutrophil cytosolic factor 4, 40kDa
Gene Name: NCF4
Alternative Gene Name: p40phox, SH3PXD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071715: 88%, ENSRNOG00000006940: 88%
Entrez Gene ID: 4689
Uniprot ID: Q15080
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
• Gene Sequence: EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
• Gene ID - Mouse: ENSMUSG00000071715
• Gene ID - Rat: ENSRNOG00000006940
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.