Anti NCF2 pAb (ATL-HPA002327 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002327-100
![Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/80745/146783/atl-hpa002327_anti-ncf2-pab-atl-hpa002327-wenhanced-validation_28406__06541.1681095563.jpg?c=2 "Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: NCF2
Alternative Gene Name: NOXA2, p67phox
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026480: 76%, ENSRNOG00000008716: 24%
Entrez Gene ID: 4688
Uniprot ID: P19878
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQ |
| Gene Sequence | QEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQ |
| Gene ID - Mouse | ENSMUSG00000026480 |
| Gene ID - Rat | ENSRNOG00000008716 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NCF2 pAb (ATL-HPA002327 w/enhanced validation) | |
| Datasheet | Anti NCF2 pAb (ATL-HPA002327 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NCF2 pAb (ATL-HPA002327 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NCF2 pAb (ATL-HPA002327 w/enhanced validation) | |
| Datasheet | Anti NCF2 pAb (ATL-HPA002327 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NCF2 pAb (ATL-HPA002327 w/enhanced validation) |
| Citations for Anti NCF2 pAb (ATL-HPA002327 w/enhanced validation) – 1 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |