Anti NBR1 pAb (ATL-HPA022999)

Atlas Antibodies

Catalog No.: ATL-HPA022999-25

Protein Description: neighbor of BRCA1 gene 1
Gene Name: NBR1
Alternative Gene Name: 1A1-3B, CA125, KIAA0049, M17S2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017119: 95%, ENSRNOG00000020730: 95%
Entrez Gene ID: 4077
Uniprot ID: Q14596
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCTSVMPMLS
• Gene Sequence: YSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCTSVMPMLS
• Gene ID - Mouse: ENSMUSG00000017119
• Gene ID - Rat: ENSRNOG00000020730
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.