Anti NBPF4 pAb (ATL-HPA045044)

Atlas Antibodies

Catalog No.: ATL-HPA045044-25

Protein Description: neuroblastoma breakpoint family, member 4
Gene Name: NBPF4
Alternative Gene Name: FLJ32833
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038170: 32%, ENSRNOG00000018220: 32%
Entrez Gene ID: 148545
Uniprot ID: Q96M43
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLSQELPEVKEQEVPEDSVNEVYLTPSVHHDVSDCHQPYSSTLSSLEDQLACSALDVASPTEAACPQGTWSGDLSHH
• Gene Sequence: RLSQELPEVKEQEVPEDSVNEVYLTPSVHHDVSDCHQPYSSTLSSLEDQLACSALDVASPTEAACPQGTWSGDLSHH
• Gene ID - Mouse: ENSMUSG00000038170
• Gene ID - Rat: ENSRNOG00000018220
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.