Anti NAV3 pAb (ATL-HPA032111)

Atlas Antibodies

Catalog No.: ATL-HPA032111-25

Protein Description: neuron navigator 3
Gene Name: NAV3
Alternative Gene Name: KIAA0938, POMFIL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020181: 82%, ENSRNOG00000052157: 85%
Entrez Gene ID: 89795
Uniprot ID: Q8IVL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STDDLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKASLS
• Gene Sequence: STDDLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKASLS
• Gene ID - Mouse: ENSMUSG00000020181
• Gene ID - Rat: ENSRNOG00000052157
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.