Anti NALCN pAb (ATL-HPA031889)

Atlas Antibodies

Catalog No.: ATL-HPA031889-25

Protein Description: sodium leak channel, non-selective
Gene Name: NALCN
Alternative Gene Name: bA430M15.1, CanIon, VGCNL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000197: 100%, ENSRNOG00000004752: 100%
Entrez Gene ID: 259232
Uniprot ID: Q8IZF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNE
• Gene Sequence: TYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNE
• Gene ID - Mouse: ENSMUSG00000000197
• Gene ID - Rat: ENSRNOG00000004752
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.