Anti NAGK pAb (ATL-HPA035206 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035206-25

Protein Description: N-acetylglucosamine kinase
Gene Name: NAGK
Alternative Gene Name: GNK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034744: 87%, ENSRNOG00000013911: 88%
Entrez Gene ID: 55577
Uniprot ID: Q9UJ70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE
• Gene Sequence: SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE
• Gene ID - Mouse: ENSMUSG00000034744
• Gene ID - Rat: ENSRNOG00000013911
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.