Anti NAE1 pAb (ATL-HPA041178 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041178-25

Protein Description: NEDD8 activating enzyme E1 subunit 1
Gene Name: NAE1
Alternative Gene Name: APPBP1, ula-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031878: 96%, ENSRNOG00000033133: 96%
Entrez Gene ID: 8883
Uniprot ID: Q13564
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDE
• Gene Sequence: PSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDE
• Gene ID - Mouse: ENSMUSG00000031878
• Gene ID - Rat: ENSRNOG00000033133
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.