Anti NADK2 pAb (ATL-HPA061492 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061492-25

• 
• 

Protein Description: NAD kinase 2, mitochondrial
Gene Name: NADK2
Alternative Gene Name: C5orf33, FLJ30596, MNADK, NADKD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111527: 93%, ENSRNOG00000054157: 96%
Entrez Gene ID: 133686
Uniprot ID: Q4G0N4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLKPVIGVNTDPERSEGHLCLPVRYTHSFPEALQKFYRGEFRWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHN
• Gene Sequence: RLKPVIGVNTDPERSEGHLCLPVRYTHSFPEALQKFYRGEFRWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHN
• Gene ID - Mouse: ENSMUSG00000111527
• Gene ID - Rat: ENSRNOG00000054157
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.