Anti NAA40 pAb (ATL-HPA037816)

Atlas Antibodies

Catalog No.: ATL-HPA037816-25

Protein Description: N(alpha)-acetyltransferase 40, NatD catalytic subunit
Gene Name: NAA40
Alternative Gene Name: FLJ13848, NAT11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024764: 99%, ENSRNOG00000021179: 97%
Entrez Gene ID: 79829
Uniprot ID: Q86UY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKV
• Gene Sequence: DLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKV
• Gene ID - Mouse: ENSMUSG00000024764
• Gene ID - Rat: ENSRNOG00000021179
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.