Anti NAA25 pAb (ATL-HPA039322)

Atlas Antibodies

Catalog No.: ATL-HPA039322-25

Protein Description: N(alpha)-acetyltransferase 25, NatB auxiliary subunit
Gene Name: NAA25
Alternative Gene Name: C12orf30, FLJ13089
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042719: 79%, ENSRNOG00000001350: 79%
Entrez Gene ID: 80018
Uniprot ID: Q14CX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLL
• Gene Sequence: TGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLL
• Gene ID - Mouse: ENSMUSG00000042719
• Gene ID - Rat: ENSRNOG00000001350
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NAA25 pAb (ATL-HPA039322) – 2 Found

Neri, Leire; Lasa, Marta; Elosegui-Artola, Alberto; D'Avola, Delia; Carte, Beatriz; Gazquez, Cristina; Alve, Sara; Roca-Cusachs, Pere; Iñarrairaegui, Mercedes; Herrero, Jose; Prieto, Jesús; Sangro, Bruno; Aldabe, Rafael. NatB-mediated protein N-α-terminal acetylation is a potential therapeutic target in hepatocellular carcinoma. Oncotarget. 2017;8(25):40967-40981. 

Xu, Jingkai; Li, Zhi; Zuo, Xianbo; Li, Guozheng; Zhang, Xuejun; Zhang, Bo; Cui, Yong. Knockdown of NAA25 Suppresses Breast Cancer Progression by Regulating Apoptosis and Cell Cycle. Frontiers In Oncology. 11( 35096568):755267.