Anti N4BP3 pAb (ATL-HPA030973 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030973-25

Protein Description: NEDD4 binding protein 3
Gene Name: N4BP3
Alternative Gene Name: LZTS4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001053: 91%, ENSRNOG00000045965: 88%
Entrez Gene ID: 23138
Uniprot ID: O15049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSPEELRAALAGSRGSRQPDGLLRKGLGQREFLSYLHLPKKDSKSTKNTKRAPRNEPADYATLYYREHSRAGDFSKTSLPERGRFD
• Gene Sequence: FSPEELRAALAGSRGSRQPDGLLRKGLGQREFLSYLHLPKKDSKSTKNTKRAPRNEPADYATLYYREHSRAGDFSKTSLPERGRFD
• Gene ID - Mouse: ENSMUSG00000001053
• Gene ID - Rat: ENSRNOG00000045965
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti N4BP3 pAb (ATL-HPA030973 w/enhanced validation) – 1 Found

Zhang, Zhiqiao; Li, Jing; He, Tingshan; Ouyang, Yanling; Huang, Yiyan; Liu, Qingbo; Wang, Peng; Ding, Jianqiang. Two predictive precision medicine tools for hepatocellular carcinoma. Cancer Cell International. 19( 31754347):290.