Anti N4BP2L1 pAb (ATL-HPA038971 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038971-25

Protein Description: NEDD4 binding protein 2-like 1
Gene Name: N4BP2L1
Alternative Gene Name: CG018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041132: 70%, ENSRNOG00000059322: 69%
Entrez Gene ID: 90634
Uniprot ID: Q5TBK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYWNSYTEFPNRRAHGGFTNESSYHRRG
• Gene Sequence: KIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYWNSYTEFPNRRAHGGFTNESSYHRRG
• Gene ID - Mouse: ENSMUSG00000041132
• Gene ID - Rat: ENSRNOG00000059322
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti N4BP2L1 pAb (ATL-HPA038971 w/enhanced validation) – 2 Found

Watanabe, Kazuhisa; Yokota, Kazuha; Yoshida, Ken; Matsumoto, Ayumi; Iwamoto, Sadahiko. A novel upstream transcription factor 1 target gene N4bp2l1 that regulates adipogenesis. Biochemistry And Biophysics Reports. 2019;20( 31440585):100676. 

Watanabe, Kazuhisa; Matsumoto, Ayumi; Tsuda, Hidetoshi; Iwamoto, Sadahiko. N4BP2L1 interacts with dynactin and contributes to GLUT4 trafficking and glucose uptake in adipocytes. Journal Of Diabetes Investigation. 2021;12(11):1958-1966.