Anti MYO6 pAb (ATL-HPA035483 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035483-25

Protein Description: myosin VI
Gene Name: MYO6
Alternative Gene Name: DFNA22, DFNB37, KIAA0389
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033577: 95%, ENSRNOG00000011852: 93%
Entrez Gene ID: 4646
Uniprot ID: Q9UM54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYD
• Gene Sequence: DGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYD
• Gene ID - Mouse: ENSMUSG00000033577
• Gene ID - Rat: ENSRNOG00000011852
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYO6 pAb (ATL-HPA035483 w/enhanced validation) – 1 Found

Cook, Alexander; Hari-Gupta, Yukti; Toseland, Christopher P. Application of the SSB biosensor to study in vitro transcription. Biochemical And Biophysical Research Communications. 2018;496(3):820-825.