Anti MYL6B pAb (ATL-HPA038887 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038887-100

Protein Description: myosin, light chain 6B, alkali, smooth muscle and non-muscle
Gene Name: MYL6B
Alternative Gene Name: MLC1SA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039824: 84%, ENSRNOG00000028837: 86%
Entrez Gene ID: 140465
Uniprot ID: P14649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKE
• Gene Sequence: APPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKE
• Gene ID - Mouse: ENSMUSG00000039824
• Gene ID - Rat: ENSRNOG00000028837
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.