Anti MYL5 pAb (ATL-HPA037381 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037381-100

Protein Description: myosin, light chain 5, regulatory
Gene Name: MYL5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020469: 54%, ENSRNOG00000014409: 53%
Entrez Gene ID: 4636
Uniprot ID: Q02045
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVI
• Gene Sequence: NAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVI
• Gene ID - Mouse: ENSMUSG00000020469
• Gene ID - Rat: ENSRNOG00000014409
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.