Anti MYBPC3 pAb (ATL-HPA043898 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043898-25

Protein Description: myosin binding protein C, cardiac
Gene Name: MYBPC3
Alternative Gene Name: CMH4, FHC, MYBP-C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002100: 93%, ENSRNOG00000012307: 93%
Entrez Gene ID: 4607
Uniprot ID: Q14896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDA
• Gene Sequence: TGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDA
• Gene ID - Mouse: ENSMUSG00000002100
• Gene ID - Rat: ENSRNOG00000012307
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYBPC3 pAb (ATL-HPA043898 w/enhanced validation) – 1 Found

McNamara, James W; Li, Amy; Lal, Sean; Bos, J Martijn; Harris, Samantha P; van der Velden, Jolanda; Ackerman, Michael J; Cooke, Roger; Dos Remedios, Cristobal G. MYBPC3 mutations are associated with a reduced super-relaxed state in patients with hypertrophic cardiomyopathy. Plos One. 12(6):e0180064.