Anti MVP pAb (ATL-HPA064740 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA064740-25

Protein Description: major vault protein
Gene Name: MVP
Alternative Gene Name: LRP, VAULT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030681: 93%, ENSRNOG00000020182: 94%
Entrez Gene ID: 9961
Uniprot ID: Q14764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVSHQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLAD
• Gene Sequence: KVSHQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLAD
• Gene ID - Mouse: ENSMUSG00000030681
• Gene ID - Rat: ENSRNOG00000020182
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.