Anti MUC17 pAb (ATL-HPA031634 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031634-25

Protein Description: mucin 17, cell surface associated
Gene Name: MUC17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037390: 47%, ENSRNOG00000049592: 37%
Entrez Gene ID: 140453
Uniprot ID: Q685J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYK
• Gene Sequence: NPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYK
• Gene ID - Mouse: ENSMUSG00000037390
• Gene ID - Rat: ENSRNOG00000049592
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MUC17 pAb (ATL-HPA031634 w/enhanced validation) – 3 Found

Finkbeiner, Walter E; Zlock, Lorna T; Morikawa, Masatoshi; Lao, Anna Y; Dasari, Vijay; Widdicombe, Jonathan H. Cystic fibrosis and the relationship between mucin and chloride secretion by cultures of human airway gland mucous cells. American Journal Of Physiology. Lung Cellular And Molecular Physiology. 2011;301(4):L402-14. 

Delker, Don A; McGettigan, Brett M; Kanth, Priyanka; Pop, Stelian; Neklason, Deborah W; Bronner, Mary P; Burt, Randall W; Hagedorn, Curt H. RNA sequencing of sessile serrated colon polyps identifies differentially expressed genes and immunohistochemical markers. Plos One. 9(2):e88367. 

Liu, Donglin; Chang, Chien-Hsing; Gold, David V; Goldenberg, David M. Identification of PAM4 (clivatuzumab)-reactive epitope on MUC5AC: a promising biomarker and therapeutic target for pancreatic cancer. Oncotarget. 2015;6(6):4274-85.