Anti MTX2 pAb (ATL-HPA031551)

Atlas Antibodies

Catalog No.: ATL-HPA031551-25

Protein Description: metaxin 2
Gene Name: MTX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027099: 97%, ENSRNOG00000001559: 93%
Entrez Gene ID: 10651
Uniprot ID: O75431
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGLEEVQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIG
• Gene Sequence: DGLEEVQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIG
• Gene ID - Mouse: ENSMUSG00000027099
• Gene ID - Rat: ENSRNOG00000001559
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MTX2 pAb (ATL-HPA031551) – 1 Found

Elouej, Sahar; Harhouri, Karim; Le Mao, Morgane; Baujat, Genevieve; Nampoothiri, Sheela; Kayserili, Hϋlya; Menabawy, Nihal Al; Selim, Laila; Paneque, Arianne Llamos; Kubisch, Christian; Lessel, Davor; Rubinsztajn, Robert; Charar, Chayki; Bartoli, Catherine; Airault, Coraline; Deleuze, Jean-François; Rötig, Agnes; Bauer, Peter; Pereira, Catarina; Loh, Abigail; Escande-Beillard, Nathalie; Muchir, Antoine; Martino, Lisa; Gruenbaum, Yosef; Lee, Song-Hua; Manivet, Philippe; Lenaers, Guy; Reversade, Bruno; Lévy, Nicolas; De Sandre-Giovannoli, Annachiara. Loss of MTX2 causes mandibuloacral dysplasia and links mitochondrial dysfunction to altered nuclear morphology. Nature Communications. 2020;11(1):4589.