Anti MTRF1 pAb (ATL-HPA043316)

Atlas Antibodies

Catalog No.: ATL-HPA043316-25

Protein Description: mitochondrial translational release factor 1
Gene Name: MTRF1
Alternative Gene Name: MGC47721, MTTRF1, RF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022022: 87%, ENSRNOG00000047106: 89%
Entrez Gene ID: 9617
Uniprot ID: O75570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IAFRVLRARLYQQIIEKDKRQQQSARKLQVGTRAQSERIRTYNFTQDRVSDHRIAYEVRDIKEFLCGGKGLDQLIQRLLQSADEEAIAELLDEHL
• Gene Sequence: IAFRVLRARLYQQIIEKDKRQQQSARKLQVGTRAQSERIRTYNFTQDRVSDHRIAYEVRDIKEFLCGGKGLDQLIQRLLQSADEEAIAELLDEHL
• Gene ID - Mouse: ENSMUSG00000022022
• Gene ID - Rat: ENSRNOG00000047106
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.