Anti MTMR14 pAb (ATL-HPA054063)

Atlas Antibodies

SKU: ATL-HPA054063-25

• 

Protein Description: myotubularin related protein 14
Gene Name: MTMR14
Alternative Gene Name: C3orf29, FLJ22405, FLJ90311, hEDTP, hJumpy
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030269: 94%, ENSRNOG00000007881: 95%
Entrez Gene ID: 64419
Uniprot ID: Q8NCE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLL
• Gene Sequence: DKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLL
• Gene ID - Mouse: ENSMUSG00000030269
• Gene ID - Rat: ENSRNOG00000007881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.