Anti MS4A4E pAb (ATL-HPA040075)

Atlas Antibodies

Catalog No.: ATL-HPA040075-25

Protein Description: membrane-spanning 4-domains, subfamily A, member 4E
Gene Name: MS4A4E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001436: 37%, ENSRNOG00000000165: 30%
Entrez Gene ID: 643680
Uniprot ID: Q96PG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQQELEQQKVWNYLKNLSWRIMGSYLCFGERSELKPL
• Gene Sequence: LQQELEQQKVWNYLKNLSWRIMGSYLCFGERSELKPL
• Gene ID - Mouse: ENSMUSG00000001436
• Gene ID - Rat: ENSRNOG00000000165
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MS4A4E pAb (ATL-HPA040075) – 1 Found

Silva-Gomes, Rita; Mapelli, Sarah N; Boutet, Marie-Astrid; Mattiola, Irene; Sironi, Marina; Grizzi, Fabio; Colombo, Federico; Supino, Domenico; Carnevale, Silvia; Pasqualini, Fabio; Stravalaci, Matteo; Porte, Rémi; Gianatti, Andrea; Pitzalis, Constantino; Locati, Massimo; Oliveira, Maria José; Bottazzi, Barbara; Mantovani, Alberto. Differential expression and regulation of MS4A family members in myeloid cells in physiological and pathological conditions. Journal Of Leukocyte Biology. 2022;111(4):817-836.