Anti MRPS35 pAb (ATL-HPA038513 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038513-25

Protein Description: mitochondrial ribosomal protein S35
Gene Name: MRPS35
Alternative Gene Name: MDS023, MRPS28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040112: 63%, ENSRNOG00000001842: 65%
Entrez Gene ID: 60488
Uniprot ID: P82673
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVK
• Gene Sequence: DMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVK
• Gene ID - Mouse: ENSMUSG00000040112
• Gene ID - Rat: ENSRNOG00000001842
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.