Anti MRPS18B pAb (ATL-HPA043485)

Atlas Antibodies

Catalog No.: ATL-HPA043485-25

Protein Description: mitochondrial ribosomal protein S18B
Gene Name: MRPS18B
Alternative Gene Name: C6orf14, HSPC183, MRPS18-2, PTD017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024436: 82%, ENSRNOG00000000804: 80%
Entrez Gene ID: 28973
Uniprot ID: Q9Y676
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMP
• Gene Sequence: GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMP
• Gene ID - Mouse: ENSMUSG00000024436
• Gene ID - Rat: ENSRNOG00000000804
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.