Anti MRPS16 pAb (ATL-HPA050081 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA050081-25

Protein Description: mitochondrial ribosomal protein S16
Gene Name: MRPS16
Alternative Gene Name: CGI-132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049960: 89%, ENSRNOG00000006898: 88%
Entrez Gene ID: 51021
Uniprot ID: Q9Y3D3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDT
• Gene Sequence: ALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDT
• Gene ID - Mouse: ENSMUSG00000049960
• Gene ID - Rat: ENSRNOG00000006898
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.