Anti MRPL42 pAb (ATL-HPA039398)

Atlas Antibodies

Catalog No.: ATL-HPA039398-25

Protein Description: mitochondrial ribosomal protein L42
Gene Name: MRPL42
Alternative Gene Name: HSPC204, MRP-L31, MRPL31, MRPS32, PTD007, RPML31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062981: 73%, ENSRNOG00000042740: 77%
Entrez Gene ID: 28977
Uniprot ID: Q9Y6G3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKD
• Gene Sequence: YEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKD
• Gene ID - Mouse: ENSMUSG00000062981
• Gene ID - Rat: ENSRNOG00000042740
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.