Anti MRPL30 pAb (ATL-HPA047255)

Atlas Antibodies

Catalog No.: ATL-HPA047255-25

Protein Description: mitochondrial ribosomal protein L30
Gene Name: MRPL30
Alternative Gene Name: MRP-L28, RPML28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026087: 89%, ENSRNOG00000049330: 89%
Entrez Gene ID: 51263
Uniprot ID: Q8TCC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQK
• Gene Sequence: AHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQK
• Gene ID - Mouse: ENSMUSG00000026087
• Gene ID - Rat: ENSRNOG00000049330
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.