Anti MRPL23 pAb (ATL-HPA050406)

Atlas Antibodies

Catalog No.: ATL-HPA050406-25

Protein Description: mitochondrial ribosomal protein L23
Gene Name: MRPL23
Alternative Gene Name: L23MRP, RPL23L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037772: 73%, ENSRNOG00000020354: 74%
Entrez Gene ID: 6150
Uniprot ID: Q16540
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL
• Gene Sequence: KRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL
• Gene ID - Mouse: ENSMUSG00000037772
• Gene ID - Rat: ENSRNOG00000020354
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.