Anti MRNIP pAb (ATL-HPA043975)

Atlas Antibodies

Catalog No.: ATL-HPA043975-25

Protein Description: MRN complex interacting protein
Gene Name: MRNIP
Alternative Gene Name: C5orf45, DKFZp686L2452, LOC51149, MGC65027, MGC78537
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020381: 31%, ENSRNOG00000003068: 39%
Entrez Gene ID: 51149
Uniprot ID: Q6NTE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGPRFSQDLPRKRKWSGSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTW
• Gene Sequence: KSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGPRFSQDLPRKRKWSGSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTW
• Gene ID - Mouse: ENSMUSG00000020381
• Gene ID - Rat: ENSRNOG00000003068
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.