Anti MPV17L2 pAb (ATL-HPA043111 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043111-100

Protein Description: MPV17 mitochondrial membrane protein-like 2
Gene Name: MPV17L2
Alternative Gene Name: FKSG24, MGC12972
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111476: 74%, ENSRNOG00000019394: 74%
Entrez Gene ID: 84769
Uniprot ID: Q567V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD
• Gene Sequence: GCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD
• Gene ID - Mouse: ENSMUSG00000111476
• Gene ID - Rat: ENSRNOG00000019394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.