Anti MPP2 pAb (ATL-HPA073483 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA073483-25

Protein Description: membrane palmitoylated protein 2
Gene Name: MPP2
Alternative Gene Name: DKFZp761D0712, DLG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017314: 100%, ENSRNOG00000059683: 100%
Entrez Gene ID: 4355
Uniprot ID: Q14168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVT
• Gene Sequence: GLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVT
• Gene ID - Mouse: ENSMUSG00000017314
• Gene ID - Rat: ENSRNOG00000059683
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.